Home > Name List By s > Sermorelin

CAS No 86168-78-7 , Sermorelin

  • Name: Sermorelin
  • Synonyms: Sermorelin (INN);Sermorelin; Sermoreline;Sermorelina; Sermorelinum; Geref (TN); Sermorelina [Spanish]; Sermorelinum [Latin]; Sermoreline [French];
  • CAS Registry Number:
  • Density: 1.45 g/cm3
  • Refractive index: 1.649
  • Molecular Weight: 3357.88214
  • InchiKey: WGWPRVFKDLAUQJ-UHFFFAOYSA-N
  • InChI: InChI=1S/C149H246N44O42S/c1-20-77(13)116(191-122(211)81(17)168-132(221)
    104(66-113(204)205)178-121(210)79(15)167-123(212)88(152)62-84-39-43-86
    (198)44-40-84)145(234)185-102(63-83-32-23-22-24-33-83)138(227)193-118(82
    (18)197)146(235)186-103(65-111(155)202)137(226)189-108(71-196)142(231)
    182-101(64-85-41-45-87(199)46-42-85)136(225)175-93(38-31-56-165-149(161)
    162)126(215)174-91(35-26-28-53-151)131(220)190-115(76(11)12)143(232)184-
    97(58-72(3)4)124(213)166-68-112(203)170-94(47-49-109(153)200)128(217)
    180-100(61-75(9)10)135(224)188-106(69-194)140(229)169-80(16)120(209)172-
    92(37-30-55-164-148(159)160)125(214)173-90(34-25-27-52-150)127(216)179-
    99(60-74(7)8)134(223)181-98(59-73(5)6)133(222)176-95(48-50-110(154)201)
    129(218)183-105(67-114(206)207)139(228)192-117(78(14)21-2)144(233)177-96
    (51-57-236-19)130(219)187-107(70-195)141(230)171-89(119(156)208)36-29-
    54-163-147(157)158/h22-24,32-33,39-46,72-82,88-108,115-118,194-199H,
    20-21,25-31,34-38,47-71,150-152H2,1-19H3,(H2,153,200)(H2,154,201)(H2,
    155,202)(H2,156,208)(H,166,213)(H,167,212)(H,168,221)(H,169,229)(H,170,
    203)(H,171,230)(H,172,209)(H,173,214)(H,174,215)(H,175,225)(H,176,
    222)(H,177,233)(H,178,210)(H,179,216)(H,180,217)(H,181,223)(H,182,
    231)(H,183,218)(H,184,232)(H,185,234)(H,186,235)(H,187,219)(H,188,
    224)(H,189,226)(H,190,220)(H,191,211)(H,192,228)(H,193,227)(H,204,
    205)(H,206,207)(H4,157,158,163)(H4,159,160,164)(H4,161,162,165)
  • Molecular Formula: C149H246N44O42S
  • Molecular Structure:CAS No:86168-78-7 Sermorelin

Related products

Search by region :

Select to

86168-78-7 Sermorelin Acetate

  • Sermorelin Acetate Sequence:H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Cas No.:86168-78-7 Molecular Formula:C149H246N44O42S Molecular Weight:3357.96 Purity (HPLC):98.0%m...
  • Min. Order: 500
  • China Wuhan Yuancheng Group [Manufacturer, Trading Company]
  • Tel: 86-027-50756153
  • Address: Zhongshan Road Wuhan,HubeiChina
Contact Supplier

86168-78-7 Sermorelin Acetate

  • Sermorelin Acetate Sequence:H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Cas No.:86168-78-7 Molecular Formula:C149H246N44O42S Molecular Weight:3357.96 Purity (HPLC):98.0%m...
  • Min. Order: 500
  • China Hubei Saichuang Group [Manufacturer, Trading Company]
  • Tel: 86-027-50756064
  • Address: Zhongshan Road wuhan,HubeiChina
Contact Supplier

86168-78-7 Sermorelin Acetate

  • Sermorelin Acetate Sequence:H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Cas No.:86168-78-7 Molecular Formula:C149H246N44O42S Molecular Weight:3357.96 Purity (HPLC):98.0%m...
  • Min. Order: 500
  • China Hubei Gongchuang Group [Manufacturer, Trading Company]
  • Tel: 86-027-15927298986
  • Address: Zhongshan Road Wuchang Wuhan,HubeiChina
Contact Supplier

86168-78-7 Sermorelin CAS: 86168-78-7

  • Sermorelin CAS: 86168-78-7 Product Name: Sermorelin Synonyms: SERMORELIN;SERMORELIN ACETATE;YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 CAS: 86168-78-7 MF: C149H246N44O42S MW: 3357.88 Product Categories: Amino Acid Derivatives;Peptide;GH-RHObesity Research;GH-...
  • Min. Order: 1000
  • FOB Price: USD1 - 100 /
  • China HBYCSC Technology Co., Ltd [Manufacturer]
  • Tel: 86-27-50756049
  • Fax: 86-27-68886696
  • Address: 496 Zhongshan Road, Wuchang District, Wuhan, Hubei,China Wuhan,HubeiChina
Contact Supplier

86168-78-7 Sermorelin Anabolic Androgenic Steroids Peptide CAS 86168-78-7

  • Sermorelin Anabolic Androgenic Steroids Peptide CAS 86168-78-7 Sermorelin 2mg (GRF 1-29) Peptide Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Molecular formula: C1...
  • FOB Price: USD1 - null /
  • China Guangzhou HuAo Chemical Co.Ltd [Manufacturer]
  • Tel: 86-020-39008914
  • Address: 1102,Unit 16, Era of Nansha District South Bay,Guangzhou,China Guangzhou,GuangdongChina
Contact Supplier

86168-78-7 Sermorelin Acetate

  • duosue at chembj dot com sk/pe: gina.yctech whats-----app ID: +8618872220799 wech/at ID: hq930818 hi,dear friend welcome to our online shop if you want buy high purity peptides raws with competive price and safe delivery Congratulations because you g...
  • Min. Order: 100
  • FOB Price: USD1 - 22 /
  • China Jinjiang PHARCHEM TECHONOLOGY Co,Ltd [Manufacturer]
  • Tel: 86-027-50756153
  • Address: NO 9449 Parking Road WUhan,nullChina
Contact Supplier

86168-78-7 Sermorelin

  • Sermorelin Model NO.:Sermorelin CAS: 86168-78-7 CAS:86168-78-7 Mf:C149h246n44o42s MW:3357.88 Assay:99% Sermorelin Peptide Origin:China Character:White Powder Payment:Western Union, Money Gram, T/T, Bitcoin Shipment:Hkems, EMS, FedEx, TNT, DHL, UPS, A...
  • Min. Order: 1
  • FOB Price: USD35.20 - 59.30 /
  • China Hubei Yuancheng Saichuang Technology Co.,Ltd [Manufacturer, Trading Company]
  • Tel: 86-027-50756254
  • Address: 496, Zhongshan Road, Wuhan Wuhan,HubeiChina
Contact Supplier

86168-78-7 Sermorelin Acetate

  • Sermorelin Acetate Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Cas No.: 86168-78-7 Molecular Formula: C149H246N44O42S Molecular Weight: 3357.96 Purity (HPLC): 98....
  • China Zhuzhou HongQiang Technology Development Co., Ltd. [Manufacturer, Trading Company]
  • Tel: 86-0731-22290217
  • Fax: --
  • Address: No. 388, Huangshan Rd, Tianyuan District, Zhuzhou City, Hunan Province, P.R.China. zhuzhou,HunanChina
Contact Supplier

86168-78-7 sell Sermorelin Acetate 86168-78-7

  • Product Name Sermorelin Acetate Sequence H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg- Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu- Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 Cas No. 86168-78-7 Molecular Formula C149H246N44O42S Molecular Weight 3357.96 Purity ...
  • FOB Price: USD1 - null /
  • China Cui [Manufacturer]
  • Tel: 86-027-50756026
  • Address: No. 496 Zhongshan Road, Wuchang District, Wuhan City, Hubei Province, China wuhan,HubeiChina
Contact Supplier

86168-78-7 Sermorelin (frank@chembj.com)

  • Sermorelin Alias: GRF 1-29 NH2, Sermorelin Acetate Hydrate CAS: 86168-78-7 Sequence: H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 MF: C149H246N44O42S MW: 3357.96 Purity: 99%...
  • Min. Order: 1000
  • FOB Price: USD1 - 2 /
  • China Zhongshan Yuanyang Bio-pharmaceutical Technology Co., Ltd [Manufacturer]
  • Tel: 86-0760-18938791194
  • Address: No.88, Road Xinwen, Zhongshan City Zhongshan,GuangdongChina
Contact Supplier

Select to

References of Sermorelin
Title: Sermorelin
CAS Registry Number: 86168-78-7
Synonyms: Human growth hormone-releasing factor(1-29)amide; human pancreatic somatoliberin(1-29)amide; GRF(1-29)NH2; hpGRF(1-29)NH2
Manufacturers' Codes: SM-8144
Trademarks: Geref (Serono); Groliberin (Kabi)
Molecular Formula: C149H246N44O42S
Molecular Weight: 3357.88
Percent Composition: C 53.30%, H 7.38%, N 18.35%, O 20.01%, S 0.95%
Literature References: Amidated fragment of human somatoliberin, q.v. Characterization of in vitro activity: J. Rivier et al., Nature 300, 276 (1982). Prepn: N. Ling et al., Biochem. Biophys. Res. Commun. 123, 854 (1984); J. E. F. Rivier et al., US 4703035 (1987 to Salk Inst. Biol. Stud.). Clinical pharmacology: M. Losa et al., Klin. Wochenschr. 62, 1140 (1984). Clinical evaluation in growth hormone deficiency: M. B. Ranke et al., Eur. J. Pediatr. 145, 485 (1986); R. Hümmelink et al., Acta Paediatr. Scand. Suppl. 331, 48 (1987). Field trial in pigs and dairy heifers: D. Petitclerc et al., J. Anim. Sci. 65, 996 (1987).
Properties: [a]D20 -63.1° (c = 1 in 30% acetic acid).
Optical Rotation: [a]D20 -63.1° (c = 1 in 30% acetic acid)
Therap-Cat: Growth hormone releasing factor.
Keywords: Growth Hormone Releasing Factor.